PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0318s00010.1
Organism
Vigna angularis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family M-type_MADS
Protein Properties Length: 69aa    MW: 7725.2 Da    PI: 11.0065
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0318s00010.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.16.6e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+i+n  nrq+tfskRrng+lKKA ELSvLCda+v viifsstgklye+s+
  Vang0318s00010.1  9 KKIDNLNNRQITFSKRRNGLLKKARELSVLCDAKVVVIIFSSTGKLYEFSN 59
                      68***********************************************95 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.973161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-29261IPR002100Transcription factor, MADS-box
CDDcd002652.20E-35260No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-30323IPR002100Transcription factor, MADS-box
PfamPF003197.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MGRGKIEIKK IDNLNNRQIT FSKRRNGLLK KARELSVLCD AKVVVIIFSS TGKLYEFSNT  60
RCLLVSPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-18160160MEF2C
5f28_B1e-18160160MEF2C
5f28_C1e-18160160MEF2C
5f28_D1e-18160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0318s00010.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-109AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145592.14e-32hypothetical protein PHAVU_007G251600g
RefseqXP_017414060.11e-32PREDICTED: agamous-like MADS-box protein AGL15 isoform X2
SwissprotQ388471e-27AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBLA0A396JS089e-31A0A396JS08_MEDTR; Putative transcription factor MADS-type1 family
TrEMBLV7BLX29e-31V7BLX2_PHAVU; Uncharacterized protein
STRINGXP_007145592.12e-31(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.14e-30AGAMOUS-like 15
Publications ? help Back to Top
  1. Zheng Q,Zheng Y,Perry SE
    Decreased GmAGL15 expression and reduced ethylene synthesis may contribute to reduced somatic embryogenesis in a poorly embryogenic cultivar of Glycine max.
    Plant Signal Behav, 2014.
    [PMID:23838957]
  2. Perry SE,Zheng Q,Zheng Y
    Transcriptome analysis indicates that GmAGAMOUS-Like 15 may enhance somatic embryogenesis by promoting a dedifferentiated state.
    Plant Signal Behav, 2016. 11(7): p. e1197463
    [PMID:27302197]
  3. Cosio C, et al.
    The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation.
    New Phytol., 2017. 213(1): p. 250-263
    [PMID:27513887]
  4. Zheng Q,Zheng Y,Ji H,Burnie W,Perry SE
    Gene Regulation by the AGL15 Transcription Factor Reveals Hormone Interactions in Somatic Embryogenesis.
    Plant Physiol., 2016. 172(4): p. 2374-2387
    [PMID:27794101]
  5. Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD
    HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 600-619
    [PMID:29475938]