![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang0346s00010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 114aa MW: 13110.9 Da PI: 9.0443 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 33.7 | 1.1e-10 | 56 | 110 | 49 | 103 |
NAM 49 kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglk 103
+++++++ ewy F +rd ky+++ + +at +gyWk tgkd +v+ k++ g k
Vang0346s00010.1 56 AAIRSRDPEWYCFGPRDWKYPNEFTTIKATPAGYWKCTGKDSKVYYKGTPPHGAK 110
46677888*************************************9877666665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00380 | 2.8E-4 | 4 | 41 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 1.57E-7 | 8 | 37 | IPR016177 | DNA-binding domain |
| Gene3D | G3DSA:3.30.730.10 | 1.0E-7 | 8 | 36 | IPR001471 | AP2/ERF domain |
| PROSITE profile | PS51032 | 9.058 | 8 | 35 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF101941 | 3.53E-12 | 55 | 109 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MLNRPCGYDK EEKAARAYDL AALKYWGTST TTNFPISNYD KELDEMKHIT RQEFVAAIRS 60 RDPEWYCFGP RDWKYPNEFT TIKATPAGYW KCTGKDSKVY YKGTPPHGAK LIV* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang0346s00010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 3e-84 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022148736.1 | 1e-28 | AP2-like ethylene-responsive transcription factor PLT2, partial | ||||
| TrEMBL | A0A151TVR7 | 9e-27 | A0A151TVR7_CAJCA; AP2-like ethylene-responsive transcription factor PLT2 | ||||
| TrEMBL | G9FSH6 | 7e-27 | G9FSH6_ELAGV; Putative APETALA2 ethylene responsive element binding protein (Fragment) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4942 | 31 | 52 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G20840.1 | 2e-27 | AP2 family protein | ||||




