PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang03g01120.1

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NF-YB

Protein Properties

Length: 90aa MW: 10010.5 Da PI: 4.6654

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang03g01120.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	118.9	2.3e-37	1	62	17	78
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfed 78 mkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfe+ Vang03g01120.1 1 MKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEE 62 9***********************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	9.4E-22	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
Gene3D	G3DSA:1.10.20.10	9.3E-34	1	62	IPR009072	Histone-fold
SuperFamily	SSF47113	8.05E-25	1	62	IPR009072	Histone-fold
PRINTS	PR00615	2.9E-12	19	37	No hit	No description
PROSITE pattern	PS00685	0	22	38	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.9E-12	38	56	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MKKALPANAK ISKEAKETVQ ECVSEFISFI TGEASDKCQK EKRKTINGDD LLWAMTTLGF 60 EEDTCMDLGV LDQHLLQELD SSRFMHVSV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-29	1	61	17	77	Transcription factor HapC (Eurofung)
4g92_B	1e-29	1	61	17	77	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang03g01120.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015038	2e-99	AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022036279.1	2e-38	nuclear transcription factor Y subunit B-3-like
Refseq	XP_027330972.1	2e-38	nuclear transcription factor Y subunit B-3 isoform X1
Swissprot	O23310	1e-37	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q75IZ7	2e-37	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A218XLJ3	2e-37	A0A218XLJ3_PUNGR; Uncharacterized protein
TrEMBL	A0A251V364	4e-37	A0A251V364_HELAN; Putative histone-fold protein
TrEMBL	A0A2I0JWR8	4e-37	A0A2I0JWR8_PUNGR; Uncharacterized protein
STRING	GLYMA15G12570.1	1e-37	(Glycine max)
STRING	XP_007147615.1	1e-37	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF591	34	150

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	6e-40	nuclear factor Y, subunit B3

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]