![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang03g17860.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 124aa MW: 14007.9 Da PI: 10.0068 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 99.9 | 9.5e-32 | 24 | 73 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey+
Vang03g17860.1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA 73
79***********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.964 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.6E-42 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.88E-46 | 17 | 91 | No hit | No description |
| SuperFamily | SSF55455 | 5.76E-34 | 17 | 94 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.8E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
MELPNQAQEG SSQKKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VVFSSRGRLY EYANNSVRAT IERYKKASAA STNAESVSEV NTQEIELQNH NNYLRAKVLS 120 LFY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-23 | 16 | 104 | 1 | 92 | MEF2C |
| 5f28_B | 1e-23 | 16 | 104 | 1 | 92 | MEF2C |
| 5f28_C | 1e-23 | 16 | 104 | 1 | 92 | MEF2C |
| 5f28_D | 1e-23 | 16 | 104 | 1 | 92 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang03g17860.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015038 | 1e-123 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017436853.1 | 5e-68 | PREDICTED: agamous-like MADS-box protein AGL1 isoform X3 | ||||
| Refseq | XP_022642937.1 | 5e-68 | agamous-like MADS-box protein AGL1 isoform X3 | ||||
| Refseq | XP_027931176.1 | 4e-68 | agamous-like MADS-box protein AGL1 isoform X3 | ||||
| Swissprot | P29381 | 6e-52 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
| Swissprot | Q40168 | 6e-52 | AG_SOLLC; Floral homeotic protein AGAMOUS | ||||
| TrEMBL | A0A0L9VAY8 | 3e-67 | A0A0L9VAY8_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A3Q0FL75 | 1e-66 | A0A3Q0FL75_VIGRR; agamous-like MADS-box protein AGL1 isoform X3 | ||||
| STRING | XP_004513719.1 | 5e-60 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.1 | 2e-54 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




