PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang05g08590.1

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NAC

Protein Properties

Length: 157aa MW: 17970.1 Da PI: 10.6878

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang05g08590.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	97.8	1.6e-30	13	89	50	127
NAM 50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 v++++ ew fF+++d+ky++g+r nr t++gyWkatgk+++++s +++l+g+kk+Lvfy grapk +kt+Wvmheyr Vang05g08590.1 13 VVRNKDPEWLFFCPHDRKYPNGHRLNRGTTHGYWKATGKNQKIKS-GSALIGMKKILVFYIGRAPKEKKTNWVMHEYR 89 4567788******************9999**********.9****************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	30.813	1	106	IPR003441	NAC domain
SuperFamily	SSF101941	3.01E-32	15	96	IPR003441	NAC domain
Pfam	PF02365	8.0E-15	18	89	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
LLGRGLFDVD LSVVRNKDPE WLFFCPHDRK YPNGHRLNRG TTHGYWKATG KNQKIKSGSA 60 LIGMKKILVF YIGRAPKEKK TNWVMHEYRP TLKELDGTNL GQVYSYLLLL LFGIFAFSSL 120 LPWCFDIKLF VSFNSSIVFF PSRGVLTRGR SKHLSL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	1e-26	6	89	57	144	NAC domain-containing protein 19
3swm_B	1e-26	6	89	57	144	NAC domain-containing protein 19
3swm_C	1e-26	6	89	57	144	NAC domain-containing protein 19
3swm_D	1e-26	6	89	57	144	NAC domain-containing protein 19
3swp_A	1e-26	6	89	57	144	NAC domain-containing protein 19
3swp_B	1e-26	6	89	57	144	NAC domain-containing protein 19
3swp_C	1e-26	6	89	57	144	NAC domain-containing protein 19
3swp_D	1e-26	6	89	57	144	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269\|PubMed:17947243, ECO:0000269\|PubMed:18443413, ECO:0000269\|PubMed:22826500, ECO:0000269\|PubMed:24329768}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang05g08590.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015035	0.0	AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017430850.1	6e-58	PREDICTED: protein NTM1-like 9 isoform X1
Refseq	XP_017430852.1	6e-58	PREDICTED: protein NTM1-like 9 isoform X2
Swissprot	F4JN35	6e-47	NTL9_ARATH; Protein NTM1-like 9
TrEMBL	A0A0L9UZJ9	1e-56	A0A0L9UZJ9_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3RLR7	1e-56	A0A0S3RLR7_PHAAN; Uncharacterized protein
STRING	XP_004502779.1	2e-55	(Cicer arietinum)
STRING	GLYMA02G38710.1	1e-55	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF21744	3	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35580.3	6e-48	NAC transcription factor-like 9

Publications ? help Back to Top
Zheng XY, et al. Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73 [PMID:26139525] Guo T, et al. Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana. Mol Plant, 2017. 10(10): p. 1334-1348 [PMID:28943325]