![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang05g08590.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 152aa MW: 17473.4 Da PI: 10.5942 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 97.9 | 1.5e-30 | 8 | 84 | 50 | 127 |
NAM 50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
v++++ ew fF+++d+ky++g+r nr t++gyWkatgk+++++s +++l+g+kk+Lvfy grapk +kt+Wvmheyr
Vang05g08590.2 8 VVRNKDPEWLFFCPHDRKYPNGHRLNRGTTHGYWKATGKNQKIKS-GSALIGMKKILVFYIGRAPKEKKTNWVMHEYR 84
4567788********************9999**************.9******************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 31.245 | 1 | 101 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 3.14E-32 | 10 | 91 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.9E-15 | 13 | 84 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 152 aa Download sequence Send to blast |
LFDVDLSVVR NKDPEWLFFC PHDRKYPNGH RLNRGTTHGY WKATGKNQKI KSGSALIGMK 60 KILVFYIGRA PKEKKTNWVM HEYRPTLKEL DGTNLGQVYS YLLLLLFGIF AFSSLLPWCF 120 DIKLFVSFNS SIVFFPSRGV LTRGRSKHLS L* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-26 | 1 | 84 | 54 | 141 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-26 | 1 | 84 | 54 | 141 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-26 | 1 | 84 | 54 | 141 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-26 | 1 | 84 | 54 | 141 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 3swm_B | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 3swm_C | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 3swm_D | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 3swp_A | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 3swp_B | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 3swp_C | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 3swp_D | 1e-26 | 1 | 84 | 57 | 144 | NAC domain-containing protein 19 |
| 4dul_A | 1e-26 | 1 | 84 | 54 | 141 | NAC domain-containing protein 19 |
| 4dul_B | 1e-26 | 1 | 84 | 54 | 141 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang05g08590.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015035 | 0.0 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017430850.1 | 5e-58 | PREDICTED: protein NTM1-like 9 isoform X1 | ||||
| Refseq | XP_017430852.1 | 5e-58 | PREDICTED: protein NTM1-like 9 isoform X2 | ||||
| Swissprot | F4JN35 | 5e-47 | NTL9_ARATH; Protein NTM1-like 9 | ||||
| TrEMBL | A0A0L9UZJ9 | 1e-56 | A0A0L9UZJ9_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A0S3RLR7 | 1e-56 | A0A0S3RLR7_PHAAN; Uncharacterized protein | ||||
| STRING | XP_004502779.1 | 1e-55 | (Cicer arietinum) | ||||
| STRING | GLYMA02G38710.1 | 1e-55 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G35580.3 | 7e-48 | NAC transcription factor-like 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




