PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang0605s00070.1

Common Name

LR48_Vigan04g106000

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WRKY

Protein Properties

Length: 87aa MW: 9989.06 Da PI: 9.7571

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang0605s00070.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	92.1	4.1e-29	1	59	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K+vk++ +pr+YY+C+ agC+vkk+ver+++d ++v +tY g Hnh+ Vang0605s00070.1 1 MDDGYKWRKYGKKTVKNNSNPRNYYKCSGAGCSVKKRVERDRNDSNYVLTTYVGVHNHH 59 69********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.6E-27	1	61	IPR003657	WRKY domain
PROSITE profile	PS50811	28.633	1	61	IPR003657	WRKY domain
SMART	SM00774	1.9E-29	1	60	IPR003657	WRKY domain
SuperFamily	SSF118290	7.98E-26	1	61	IPR003657	WRKY domain
Pfam	PF03106	7.7E-23	2	59	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MDDGYKWRKY GKKTVKNNSN PRNYYKCSGA GCSVKKRVER DRNDSNYVLT TYVGVHNHHT 60 PSSYYTQMPL LHSDDWNLLP SATQNS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-21	1	62	17	78	Probable WRKY transcription factor 4
2lex_A	4e-21	1	62	17	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang0605s00070.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015035	1e-106	AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017421243.1	2e-59	PREDICTED: probable WRKY transcription factor 51
Swissprot	Q93WU9	2e-31	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	A0A0L9UE90	4e-58	A0A0L9UE90_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3REI8	4e-58	A0A0S3REI8_PHAAN; Uncharacterized protein
STRING	XP_007137588.1	3e-50	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1120	34	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	7e-34	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024] Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]