![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang06g13790.3 | ||||||||
| Common Name | LR48_Vigan02g137100 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 143aa MW: 15926.9 Da PI: 6.6702 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 35.7 | 2.2e-11 | 15 | 52 | 17 | 56 |
AP2 17 AeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
AeIrd + ng +r++lg+f +ae Aa a+++a+ +++g+
Vang06g13790.3 15 AEIRDTTRNG--TRVWLGTFESAEAAALAYDQAAFSMRGH 52
9****54465..**************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51032 | 15.646 | 1 | 59 | IPR001471 | AP2/ERF domain |
| SMART | SM00380 | 1.8E-19 | 8 | 65 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 5.69E-15 | 14 | 60 | IPR016177 | DNA-binding domain |
| Gene3D | G3DSA:3.30.730.10 | 1.5E-20 | 15 | 60 | IPR001471 | AP2/ERF domain |
| Pfam | PF00847 | 6.7E-7 | 19 | 52 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 143 aa Download sequence Send to blast |
MRSYTYYHSF TSDSAEIRDT TRNGTRVWLG TFESAEAAAL AYDQAAFSMR GHNAVLNFPV 60 KRVKESLQEI QYTCFSGSSP ALALKERHCI LRKVSSQAKK CKGKHPSEDP TPSLLVLEDL 120 GVEYLEHLLS ISDQSESPSF FD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gcc_A | 1e-18 | 14 | 61 | 15 | 62 | ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1 |
| 2gcc_A | 1e-18 | 14 | 61 | 18 | 65 | ATERF1 |
| 3gcc_A | 1e-18 | 14 | 61 | 18 | 65 | ATERF1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression during the plant development, and/or mediated by stress factors and by components of stress signal transduction pathways. Seems to be a key integrator of ethylene and jasmonate signals in the regulation of ethylene/jasmonate-dependent defenses. Can mediate resistance to necrotizing fungi (Botrytis cinerea and Plectosphaerella cucumerina) and to soil borne fungi (Fusarium oxysporum conglutinans and Fusiarium oxysporum lycopersici), but probably not to necrotizing bacteria (Pseudomonas syringae tomato). {ECO:0000269|PubMed:11950980, ECO:0000269|PubMed:12060224, ECO:0000269|PubMed:12509529, ECO:0000269|PubMed:15242170, ECO:0000269|PubMed:9851977}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang06g13790.3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by Pseudomonas syringae tomato (both virulent and avirulent avrRpt2 strains), independently of PAD4. Ethylene induction is completely dependent on functional ETHYLENE-INSENSITIVE2 (EIN2), ETHYLENE-INSENSITIVE3 (EIN3), which is itself a transcription factor and CORONATIVE-INSENSITIVE1 (COI1) proteins. Induction by jasmonate, B.cinerea or F.oxysporum as well as the synergistic induction by ethylene and jasmonate requires EIN2 and COI1. Induction by methyl jasmonate (MeJA) is independent of JAR1. Induction by salicylic acid (SA) is dependent on NPR1 but not on PAD4. Seems not to be induced by Alternaria brassicicola. {ECO:0000269|PubMed:11950980, ECO:0000269|PubMed:12060224, ECO:0000269|PubMed:12509529, ECO:0000269|PubMed:12805630, ECO:0000269|PubMed:15242170, ECO:0000269|PubMed:9851977}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015041 | 0.0 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017413084.1 | 1e-103 | PREDICTED: ethylene-responsive transcription factor 1B-like | ||||
| Swissprot | Q8LDC8 | 4e-40 | ERF92_ARATH; Ethylene-responsive transcription factor 1B | ||||
| TrEMBL | A0A0L9TXJ1 | 1e-102 | A0A0L9TXJ1_PHAAN; Uncharacterized protein | ||||
| STRING | XP_007144910.1 | 3e-69 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF311 | 33 | 199 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G23240.1 | 4e-33 | ethylene response factor 1 | ||||




