![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang06g16250.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 96aa MW: 10711.3 Da PI: 10.0538 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.4 | 1.4e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+grWT eEde+l+++++ G g+W++ ++ g+ R++k+c++rw +yl
Vang06g16250.1 14 KGRWTSEEDEILAKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
79******************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 6.6E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 20.753 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.9E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.3E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.01E-20 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.56E-9 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-6 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MGRAPCCEKV GLKKGRWTSE EDEILAKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY 60 LRADLKRGNI SAQEENTIVK LHASLGNRSA PLYYT* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00668 | SELEX | Transfer from GRMZM2G016020 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang06g16250.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT093463 | 6e-94 | BT093463.1 Soybean clone JCVI-FLGm-17G16 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017413931.1 | 8e-57 | PREDICTED: transcription factor MYB12-like | ||||
| Swissprot | Q9FJ07 | 7e-49 | MY111_ARATH; Transcription factor MYB111 | ||||
| TrEMBL | A0A0L9TWH0 | 2e-55 | A0A0L9TWH0_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A0S3SSH3 | 2e-55 | A0A0S3SSH3_PHAAN; Uncharacterized protein | ||||
| STRING | XP_008350120.1 | 1e-54 | (Malus domestica) | ||||
| STRING | GLYMA02G01740.1 | 2e-54 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49330.1 | 3e-51 | myb domain protein 111 | ||||




