PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang07g03460.1

Common Name

LR48_Vigan06g013500

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

MYB

Protein Properties

Length: 180aa MW: 20755.6 Da PI: 9.8634

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang07g03460.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	65.7	8.3e-21	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++++ +G ++WktIa + g++R++k+c++rw++yl Vang07g03460.1 10 RGAWTAEEDQRLAQCIEIHGAKRWKTIAVKSGLNRCGKSCRLRWLNYL 57 89********************************************97 PP
2	Myb_DNA-binding	53.7	4.9e-17	63	107	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + eE++l+++++k+lG++ W++Ia++++ gRt++++k++w++ Vang07g03460.1 63 RGNISVEEEDLIIRLHKLLGNR-WALIAKRLP-GRTDNEIKNYWNTC 107 78999***************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.949	5	57	IPR017930	Myb domain
SMART	SM00717	9.9E-16	9	59	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.26E-30	10	104	IPR009057	Homeodomain-like
Pfam	PF00249	5.2E-18	10	57	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.3E-24	11	64	IPR009057	Homeodomain-like
CDD	cd00167	1.89E-11	12	57	No hit	No description
PROSITE profile	PS51294	25.468	58	112	IPR017930	Myb domain
SMART	SM00717	8.2E-15	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	9.4E-16	63	107	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-25	65	112	IPR009057	Homeodomain-like
CDD	cd00167	1.40E-11	67	106	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009957	Biological Process	epidermal cell fate specification
GO:0010090	Biological Process	trichome morphogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0048629	Biological Process	trichome patterning
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MASPKKTNSR GAWTAEEDQR LAQCIEIHGA KRWKTIAVKS GLNRCGKSCR LRWLNYLRPN 60 IKRGNISVEE EDLIIRLHKL LGNRWALIAK RLPGRTDNEI KNYWNTCLCK KVNHHKKVKP 120 ETSMAQPTHS TQNTEEKVAV EHKVATDDGN GYSEVNFDFN EFFNFSIEGL YSFDWFRSS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-30	10	112	4	105	MYB PROTO-ONCOGENE PROTEIN
1mse_C	1e-30	10	112	4	105	C-Myb DNA-Binding Domain
1msf_C	1e-30	10	112	4	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang07g03460.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015043	1e-161	AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017426188.1	1e-133	PREDICTED: transcription factor MYB114-like
Swissprot	P10290	1e-48	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A0L9UQK8	1e-132	A0A0L9UQK8_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3T5E4	1e-132	A0A0S3T5E4_PHAAN; Uncharacterized protein
STRING	GLYMA01G41610.2	1e-104	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	2e-50	myb domain protein 66

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]