![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang08g00620.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 54aa MW: 6661.69 Da PI: 10.5144 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 54.6 | 2.9e-17 | 2 | 49 | 38 | 86 |
trihelix 38 mrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
mr+ g++r++k+ kekwen+nk++k++ke++k+r e+s+tcpyf+q++
Vang08g00620.2 2 MRKLGYNRNAKRSKEKWENINKYFKEVKESNKRR-LEDSKTCPYFQQMD 49
899*****************************98.68889********8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF13837 | 4.0E-10 | 2 | 50 | No hit | No description |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 54 aa Download sequence Send to blast |
LMRKLGYNRN AKRSKEKWEN INKYFKEVKE SNKRRLEDSK TCPYFQQMDV LYR* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang08g00620.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015042 | 3e-85 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002465995.2 | 4e-25 | trihelix transcription factor GTL1 | ||||
| Swissprot | Q9C882 | 4e-22 | GTL1_ARATH; Trihelix transcription factor GTL1 | ||||
| TrEMBL | A0A0A9NHJ6 | 4e-24 | A0A0A9NHJ6_ARUDO; Uncharacterized protein | ||||
| STRING | XP_002532429.1 | 2e-24 | (Ricinus communis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G76880.1 | 2e-26 | Trihelix family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




