![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang08g00900.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 135aa MW: 15368.3 Da PI: 7.5987 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.1 | 7.6e-33 | 43 | 101 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk++ +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
Vang08g00900.1 43 LDDGYRWRKYGQKAVKNNMHPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 101
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF118290 | 1.2E-28 | 36 | 102 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.0E-31 | 36 | 101 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.08 | 38 | 103 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.5E-38 | 43 | 102 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.1E-26 | 44 | 101 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MDSQDPPNSS PFVFTPTSMM QNPLEPQGLH DDIDWTRSAD DILDDGYRWR KYGQKAVKNN 60 MHPRSYYRCT HHTCNVKKQV QRLSKDTSIV VTTYEGIHNH PCEKLMETLT PLLKQMQFLS 120 SLGSNNNTSP ASLL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 8e-25 | 36 | 100 | 10 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 8e-25 | 36 | 100 | 10 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang08g00900.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015042 | 1e-117 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017441991.1 | 2e-68 | PREDICTED: probable WRKY transcription factor 24 | ||||
| Swissprot | Q8VWQ4 | 3e-52 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| TrEMBL | A0A0S3SZ32 | 4e-68 | A0A0S3SZ32_PHAAN; Uncharacterized protein | ||||
| STRING | XP_007135144.1 | 7e-66 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3227 | 34 | 71 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G64000.1 | 1e-54 | WRKY DNA-binding protein 56 | ||||




