![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang08g01570.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 133aa MW: 14742.5 Da PI: 9.7943 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 91.5 | 6.6e-29 | 69 | 125 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
dDgyn rKYGqK+vkgs+f+rsYY+Ct+++Cpvkk++ers +++v+ i+Y+geHnh+
Vang08g01570.1 69 DDGYNSRKYGQKHVKGSDFSRSYYKCTHPNCPVKKNLERSL-EGHVTAIIYKGEHNHQ 125
8****************************************.***************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.9E-24 | 56 | 126 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 8.24E-22 | 66 | 126 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 18.418 | 68 | 127 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.3E-26 | 68 | 126 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.3E-21 | 69 | 125 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MLAQVTSHSN VEIQAEYPFS TTVPATSLTQ VPTTISTTVS ASRVTESFGF SHSDKKFHSS 60 VVIVDKPNDD GYNSRKYGQK HVKGSDFSRS YYKCTHPNCP VKKNLERSLE GHVTAIIYKG 120 EHNHQHKMKK GT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ayd_A | 2e-15 | 69 | 124 | 15 | 71 | WRKY transcription factor 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang08g01570.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015042 | 0.0 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017408554.1 | 5e-80 | PREDICTED: probable WRKY transcription factor 4 | ||||
| Swissprot | Q9ZQ70 | 3e-33 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
| TrEMBL | A0A0L9TDB8 | 1e-78 | A0A0L9TDB8_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A0S3R2C6 | 1e-78 | A0A0S3R2C6_PHAAN; Uncharacterized protein | ||||
| STRING | XP_007157850.1 | 3e-60 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1545 | 34 | 100 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03340.1 | 1e-35 | WRKY DNA-binding protein 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




