PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang08g06450.4
Organism
Vigna angularis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WRKY
Protein Properties Length: 92aa    MW: 10950.2 Da    PI: 8.6007
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang08g06450.4genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.6e-331775159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                    ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  Vang08g06450.4 17 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 75
                    59********************************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-35275IPR003657WRKY domain
SuperFamilySSF1182901.27E-29975IPR003657WRKY domain
PROSITE profilePS5081129.5851274IPR003657WRKY domain
SMARTSM007746.3E-381776IPR003657WRKY domain
PfamPF031063.7E-261874IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
LREPRFCFQT RSDVDVLDDG YKWRKYGQKV VKNSLHPRSY YRCTHNNCRV KKRVERLSED  60
CRMVITTYEG RHNHSPCDDS NSSEHECFTS F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-28874874Probable WRKY transcription factor 4
2lex_A5e-28874874Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang08g06450.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150428e-87AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521060.13e-64probable WRKY transcription factor 12
RefseqXP_028225005.13e-64probable WRKY transcription factor 12
SwissprotQ93WY44e-58WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0B2PRL99e-63A0A0B2PRL9_GLYSO; Putative WRKY transcription factor 12
TrEMBLA0A445LA927e-63A0A445LA92_GLYSO; Putative WRKY transcription factor 12
TrEMBLI1JMP17e-63I1JMP1_SOYBN; Uncharacterized protein
STRINGGLYMA03G25770.11e-63(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.12e-60WRKY family protein
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Yang L, et al.
    PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa.
    Sci Rep, 2016. 6: p. 18643
    [PMID:26819184]
  3. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  4. Han Y, et al.
    WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 149-159
    [PMID:30617455]