![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang1097s00010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 98aa MW: 10830.2 Da PI: 7.3843 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 115.5 | 3.3e-36 | 11 | 88 | 1 | 78 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78
+CaaCk++rrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+ +red+++sl+yeAear+rdPvy av+
Vang1097s00010.1 11 PCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDVVKSLAYEAEARLRDPVYEAVE 88
7*************************************************************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 21.998 | 10 | 97 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 2.9E-36 | 11 | 88 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MSSSLSSSNS PCAACKIQRR KCTQECVFAP YFPPDNPQRF AYVHKVFGAS NVAKLLNELN 60 AAQREDVVKS LAYEAEARLR DPVYEAVESG HHWVALE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-37 | 2 | 87 | 2 | 87 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-37 | 2 | 87 | 2 | 87 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang1097s00010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015038 | 1e-163 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017406472.1 | 4e-59 | PREDICTED: LOB domain-containing protein 6-like | ||||
| Swissprot | Q9FKZ3 | 7e-43 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
| TrEMBL | A0A0S3REJ9 | 8e-58 | A0A0S3REJ9_PHAAN; Uncharacterized protein | ||||
| STRING | GLYMA04G11991.1 | 2e-51 | (Glycine max) | ||||
| STRING | GLYMA06G11181.1 | 2e-51 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2353 | 34 | 84 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66870.1 | 1e-42 | ASYMMETRIC LEAVES 2-like 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




