![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vang11g18130.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 124aa MW: 13965.9 Da PI: 9.8042 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 86.8 | 2.2e-27 | 1 | 49 | 10 | 59 |
ZF-HD_dimer 10 lkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
lkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC CHRnFHR+eve
Vang11g18130.2 1 LKNHAAAMGGNATDGCGEFMPS-GEEGTIEALNCSACHCHRNFHRKEVEG 49
69*******************9.999*********************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04770 | 4.5E-24 | 1 | 47 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 3.3E-27 | 1 | 47 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 23.71 | 1 | 46 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 3.0E-22 | 1 | 50 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| SuperFamily | SSF46689 | 3.41E-20 | 46 | 115 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-31 | 46 | 116 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01565 | 3.5E-28 | 54 | 110 | IPR006455 | Homeodomain, ZF-HD class |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0048574 | Biological Process | long-day photoperiodism, flowering | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
LKNHAAAMGG NATDGCGEFM PSGEEGTIEA LNCSACHCHR NFHRKEVEGE PSSKKRFRTK 60 FTQEQKEKML NFAERVGWKI QKQEESVVQQ FCQEIGVKRR VLKVWMHNNK HNLAKKNPPT 120 AAA* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wh5_A | 2e-25 | 54 | 112 | 17 | 75 | ZF-HD homeobox family protein |
| 1wh7_A | 2e-25 | 53 | 112 | 16 | 75 | ZF-HD homeobox family protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Essential protein. Putative transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vang11g18130.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 1e-115 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020693549.1 | 2e-61 | zinc-finger homeodomain protein 3-like | ||||
| Refseq | XP_020693554.1 | 2e-61 | zinc-finger homeodomain protein 3-like | ||||
| Refseq | XP_020693559.1 | 2e-61 | zinc-finger homeodomain protein 3-like | ||||
| Refseq | XP_020693580.1 | 2e-61 | zinc-finger homeodomain protein 3-like | ||||
| Refseq | XP_020693597.1 | 2e-61 | zinc-finger homeodomain protein 3-like | ||||
| Refseq | XP_028553903.1 | 2e-61 | zinc-finger homeodomain protein 3-like | ||||
| Swissprot | Q9SB61 | 1e-47 | ZHD2_ARATH; Zinc-finger homeodomain protein 2 | ||||
| TrEMBL | A0A438E9T7 | 1e-67 | A0A438E9T7_VITVI; Zinc-finger homeodomain protein 2 | ||||
| STRING | GSMUA_Achr10P11020_001 | 7e-67 | (Musa acuminata) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G24660.1 | 4e-50 | homeobox protein 22 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




