PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang2002s00010.1

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WOX

Protein Properties

Length: 97aa MW: 10991.2 Da PI: 10.2303

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang2002s00010.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	23.8	7.4e-08	3	40	24	57
S--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 24 ypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +p ++e++ + +l ++ +++V +WFqNr+ + k+ Vang2002s00010.1 3 NPPRDEIRNIWVQLqeygQVGDANVLYWFQNRKSRSKN 40 788999999999999999*****************995 PP
2	Wus_type_Homeobox	61.9	1.4e-20	1	41	24	64
Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 +++P+++ei++i +L+eyG+++d+NV yWFQNrk+R+++k Vang2002s00010.1 1 MVNPPRDEIRNIWVQLQEYGQVGDANVLYWFQNRKSRSKNK 41 79*************************************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00046	2.5E-5	3	39	IPR001356	Homeobox domain
SuperFamily	SSF46689	5.7E-6	3	44	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MVNPPRDEIR NIWVQLQEYG QVGDANVLYW FQNRKSRSKN KLRHIQNSKN HNTETQPNSI 60 SLSQIIPPST SSSSSDKSSS KELVHPNAIS LNQNYL*

Functional Description ? help Back to Top
Source	Description
UniProt	Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269\|PubMed:15753038, ECO:0000269\|PubMed:17706632, ECO:0000269\|PubMed:20110319, ECO:0000269\|PubMed:21057190, ECO:0000303\|PubMed:21185286}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang2002s00010.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269\|PubMed:21316593}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015038	1e-162	AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014506392.1	9e-42	WUSCHEL-related homeobox 9-like
Refseq	XP_022640191.1	9e-42	WUSCHEL-related homeobox 9-like
Swissprot	Q6X7J4	1e-20	WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBL	A0A0L9TLW3	6e-41	A0A0L9TLW3_PHAAN; Uncharacterized protein
TrEMBL	A0A1S3UK30	2e-40	A0A1S3UK30_VIGRR; WUSCHEL-related homeobox 9-like
STRING	XP_007153888.1	6e-37	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5898	31	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33880.1	2e-22	homeobox-3

Publications ? help Back to Top
Wang W, et al. Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice. PLoS Genet., 2014. 10(3): p. e1004154 [PMID:24625559] Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce. J. Exp. Bot., 2014. 65(22): p. 6543-52 [PMID:25205582] Raines T, et al. The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis. Plant J., 2016. 85(1): p. 134-47 [PMID:26662515] Dolzblasz A, et al. Stem Cell Regulation by Arabidopsis WOX Genes. Mol Plant, 2016. 9(7): p. 1028-39 [PMID:27109605] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374]