![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi0048s00470.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 131aa MW: 15074.4 Da PI: 10.1081 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 108.9 | 2.4e-34 | 43 | 100 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
Vradi0048s00470.1 43 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSFQDPTTVITTYEGQHNHP 100
8********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 7.5E-36 | 27 | 102 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.48E-30 | 34 | 102 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 32.983 | 37 | 102 | IPR003657 | WRKY domain |
| SMART | SM00774 | 7.5E-39 | 42 | 101 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.1E-26 | 43 | 100 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MFPYEKALSG LVIGRNKDKK KGEKKQKEPR FAFMTKSEVD HLEDGYRWRK YGQKAVKNSP 60 YPRSYYRCTT QKCTVKKRVE RSFQDPTTVI TTYEGQHNHP VPTSLRGNAA AGILLLMLCF 120 EVGWLDIDLL * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-30 | 32 | 102 | 7 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-30 | 32 | 102 | 7 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00440 | DAP | Transfer from AT4G18170 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi0048s00470.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 2e-76 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014490099.1 | 2e-67 | probable WRKY transcription factor 28 | ||||
| Swissprot | Q8VWJ2 | 7e-54 | WRK28_ARATH; WRKY transcription factor 28 | ||||
| TrEMBL | A0A1S3T8K6 | 6e-66 | A0A1S3T8K6_VIGRR; probable WRKY transcription factor 28 | ||||
| TrEMBL | A0A371GPW5 | 3e-66 | A0A371GPW5_MUCPR; Putative WRKY transcription factor 28 (Fragment) | ||||
| STRING | Gorai.009G157300.1 | 3e-57 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2231 | 34 | 83 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29860.1 | 3e-53 | WRKY DNA-binding protein 71 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




