PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vradi01g07040.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

M-type_MADS

Protein Properties

Length: 196aa MW: 22741.5 Da PI: 9.539

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi01g07040.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	94.6	4.6e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +rienk+nrqvtfskRr g+lKKA+ELSvLCdaeva+i+fss+gkl+ yss Vradi01g07040.1 9 ERIENKINRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSSRGKLFQYSS 59 69***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.497	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.3E-38	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.92E-32	2	79	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.46E-40	2	78	No hit	No description
PRINTS	PR00404	2.1E-30	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	6.8E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-30	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 196 aa Download sequence Send to blast
MGRGRVVLER IENKINRQVT FSKRRSGLLK KAFELSVLCD AEVALIVFSS RGKLFQYSST 60 DINKIVERYR QCRYSKLQTG DSSELESQSS YHEFLKLRAK YESLERTQSY TYLQVRKMED 120 LNKQLESKEK DEFSSLILEN NNFFQLHATQ ADQFESGTTL NTCRFQQQDV GSKERAVDTR 180 KEGNHSTHTK SNGWL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-24	1	69	1	69	MEF2C
5f28_B	2e-24	1	69	1	69	MEF2C
5f28_C	2e-24	1	69	1	69	MEF2C
5f28_D	2e-24	1	69	1	69	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269\|PubMed:19820190, ECO:0000269\|Ref.8}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi01g07040.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT093681	1e-130	BT093681.1 Soybean clone JCVI-FLGm-14A18 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014509646.1	1e-129	truncated transcription factor CAULIFLOWER D isoform X1
Swissprot	Q6EU39	1e-46	MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBL	A0A1S3UU87	1e-128	A0A1S3UU87_VIGRR; truncated transcription factor CAULIFLOWER D isoform X1
STRING	GLYMA16G32540.1	1e-104	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF13223	17	30

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G15800.1	1e-43	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Zhang J,Nallamilli BR,Mujahid H,Peng Z OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Conrad LJ, et al. The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] Zhang J, et al. Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Zhang B, et al. A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609]