![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi0227s00040.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 117aa MW: 12541.2 Da PI: 4.5027 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 57.8 | 3.1e-18 | 4 | 57 | 47 | 100 |
DUF260 47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
k+lpe +r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal+++e
Vradi0227s00040.1 4 KELPEYQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQVDVLQTQLALAQAE 57
578999*******************************************99976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 11.176 | 1 | 58 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 3.4E-16 | 4 | 55 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MTDKELPEYQ RSDAVSSMVY EANARVRDPV YGCVGAISSL QQQVDVLQTQ LALAQAEVVH 60 MKLSQVSTSS EQLKAVPATS NSSSENLSPS SKLAKTLFAM DMVVDQPNMG VSLWSC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 8e-19 | 5 | 76 | 58 | 129 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 8e-19 | 5 | 76 | 58 | 129 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi0227s00040.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015039 | 1e-180 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014490538.1 | 2e-75 | LOB domain-containing protein 4 | ||||
| Refseq | XP_017406211.1 | 2e-75 | PREDICTED: LOB domain-containing protein 4-like | ||||
| Swissprot | Q9SHE9 | 7e-28 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
| TrEMBL | A0A0L9T7V0 | 6e-74 | A0A0L9T7V0_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A0S3SAJ9 | 6e-74 | A0A0S3SAJ9_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A1S3T9U5 | 6e-74 | A0A1S3T9U5_VIGRR; LOB domain-containing protein 4 | ||||
| STRING | XP_007133379.1 | 1e-57 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1334 | 34 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31320.1 | 2e-20 | LOB domain-containing protein 4 | ||||




