![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi0235s00070.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 139aa MW: 15402.8 Da PI: 10.7494 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 67.1 | 4.9e-21 | 81 | 138 | 62 | 120 |
NAM 62 skrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektd 120
++d+ky++g+r nrat++gyWkatgkd++++s +++l+g+kktLvfy+grapkg++t+
Vradi0235s00070.1 81 KTKDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GSALIGMKKTLVFYTGRAPKGKRTN 138
5689*****************************.9**********************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 17.544 | 17 | 138 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 3.92E-21 | 81 | 138 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.6E-6 | 90 | 129 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MARGFGAKKM KVMRNGGGVA ACLRGEDDEN ARLVRCENLF EDGNHLYRVL DDDLIVVSQC 60 HNISRGISTL KPKPLAENCV KTKDRKYPNG HRLNRATNHG YWKATGKDRK IKSGSALIGM 120 KKTLVFYTGR APKGKRTN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 3swm_B | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 3swm_C | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 3swm_D | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 3swp_A | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 3swp_B | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 3swp_C | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 3swp_D | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
| 4dul_A | 2e-16 | 83 | 138 | 79 | 134 | NAC domain-containing protein 19 |
| 4dul_B | 2e-16 | 83 | 138 | 79 | 134 | NAC domain-containing protein 19 |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi0235s00070.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015036 | 2e-76 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. | |||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G35580.3 | 1e-27 | NAC transcription factor-like 9 | ||||




