PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vradi0261s00060.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WRKY

Protein Properties

Length: 125aa MW: 13764.7 Da PI: 8.618

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi0261s00060.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	56.8	4.3e-18	76	117	18	59
-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 18 sefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 f rsYY+C +gCpv+k+ver+a+d kvv +tYeg+Hnh+ Vradi0261s00060.1 76 HSFCRSYYKCVAPGCPVRKHVERAANDMKVVLTTYEGKHNHD 117 5689*************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.4E-28	23	118	IPR003657	WRKY domain
PROSITE profile	PS50811	24.627	33	119	IPR003657	WRKY domain
SMART	SM00774	5.0E-18	38	118	IPR003657	WRKY domain
Pfam	PF03106	5.2E-13	74	117	IPR003657	WRKY domain
SuperFamily	SSF118290	9.81E-14	75	118	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 125 aa Download sequence Send to blast
MGEEDFEKTS QISCSGAGSR IVKEPRVMVQ TTSEIDILDD GYRSTKYGRE VVKGNPNPSV 60 AISLLPPHKA MTYSKHSFCR SYYKCVAPGC PVRKHVERAA NDMKVVLTTY EGKHNHDVTT 120 TPAM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-30	29	118	8	76	Probable WRKY transcription factor 4
2lex_A	1e-30	29	118	8	76	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269\|PubMed:15618416, ECO:0000269\|PubMed:19199048, ECO:0000269\|PubMed:26025535}.
UniProt	Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250\|UniProtKB:Q6IEQ7, ECO:0000250\|UniProtKB:Q6QHD1}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi0261s00060.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250\|UniProtKB:Q6B6R4, ECO:0000269\|PubMed:15618416, ECO:0000269\|PubMed:19199048}.
UniProt	INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250\|UniProtKB:Q6IEQ7, ECO:0000269\|PubMed:16919842, ECO:0000269\|PubMed:25110688}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015042	1e-80	AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017441624.1	1e-48	PREDICTED: probable WRKY transcription factor 33
Swissprot	Q6B6R4	1e-35	WRK24_ORYSI; WRKY transcription factor WRKY24
Swissprot	Q6IEQ7	1e-35	WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBL	A0A0L9VSB5	3e-47	A0A0L9VSB5_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3SXL6	3e-47	A0A0S3SXL6_PHAAN; Uncharacterized protein
STRING	XP_007134624.1	6e-45	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G38470.1	1e-37	WRKY DNA-binding protein 33

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Zhang ZL, et al. A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells. Plant Mol. Biol., 2009. 70(1-2): p. 139-51 [PMID:19199048] Basu S,Roychoudhury A Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance. Biomed Res Int, 2014. 2014: p. 706890 [PMID:25110688] Zhang L, et al. Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells. Plant Sci., 2015. 236: p. 214-22 [PMID:26025535]