![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi0270s00050.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 130aa MW: 14426.2 Da PI: 8.3278 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 50.6 | 3.8e-16 | 21 | 57 | 23 | 60 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
YY+Ct+++Cp+kkkvers d++++ei+Y+++Hnh+k
Vradi0270s00050.1 21 CYYKCTYPSCPTKKKVERSL-DGQITEIVYKSSHNHPK 57
6*******************.***************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 1.7E-7 | 14 | 57 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.8E-12 | 20 | 59 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.0E-10 | 20 | 56 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.62E-11 | 20 | 58 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 10.739 | 22 | 58 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MSKKLLCHLS VLFLKASSIT CYYKCTYPSC PTKKKVERSL DGQITEIVYK SSHNHPKPQA 60 NKRNSLSASS LAINNVNNEI TQATHHMDSV ATPEKSSISM EDDDFGKSKS GGDEFDNDEP 120 DAKKMENRR* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi0270s00050.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015038 | 1e-148 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014489595.1 | 2e-64 | WRKY transcription factor WRKY24 | ||||
| Swissprot | Q6B6R4 | 1e-31 | WRK24_ORYSI; WRKY transcription factor WRKY24 | ||||
| TrEMBL | A0A1S3T755 | 4e-63 | A0A1S3T755_VIGRR; WRKY transcription factor WRKY24 | ||||
| STRING | XP_007146842.1 | 5e-51 | (Phaseolus vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38470.1 | 2e-20 | WRKY DNA-binding protein 33 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




