![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi02g08010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 177aa MW: 20668.9 Da PI: 10.8685 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.7 | 4.7e-17 | 91 | 138 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEd +lv +++++G ++W+ +r g+ R++k+c++rw +yl
Vradi02g08010.1 91 KGLWSPEEDTKLVAYITRYGHRNWSQLPRFAGLARCGKSCRLRWMNYL 138
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.673 | 1 | 36 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.98E-10 | 4 | 58 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 4.5E-6 | 7 | 47 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-12 | 7 | 50 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-23 | 84 | 141 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 22.641 | 86 | 142 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.1E-11 | 90 | 140 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.5E-14 | 91 | 138 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 7.65E-23 | 93 | 167 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.33E-10 | 94 | 138 | No hit | No description |
| PROSITE profile | PS50090 | 4.333 | 139 | 176 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-9 | 142 | 166 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
MSPGFWKWRQ LPKFAGLARS GKSCRLRWMN HLRPKIRKAH FSSEEEEYII GMHTKLDGLL 60 FRLSYQEESK NKESTSSMVR TPSSNKSGLR KGLWSPEEDT KLVAYITRYG HRNWSQLPRF 120 AGLARCGKSC RLRWMNYLRP NVKRGNFTPQ EEDCIIRMHK KLGNKYVSSL PYAVIQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 2e-15 | 89 | 168 | 25 | 103 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250|UniProtKB:Q9M2D9}. | |||||
| UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. | |||||
| UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi02g08010.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA) and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015039 | 3e-63 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022634320.1 | 2e-60 | transcription factor MYB14-like | ||||
| Swissprot | Q7XBH4 | 6e-36 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
| Swissprot | Q9FJP2 | 1e-35 | MYB53_ARATH; Transcription factor MYB53 | ||||
| Swissprot | Q9SJX8 | 4e-36 | MYB14_ARATH; Transcription factor MYB14 | ||||
| TrEMBL | A0A3Q0ERK6 | 5e-59 | A0A3Q0ERK6_VIGRR; transcription factor MYB14-like | ||||
| STRING | GLYMA12G11390.1 | 2e-48 | (Glycine max) | ||||
| STRING | XP_007132612.1 | 3e-48 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31180.1 | 2e-38 | myb domain protein 14 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




