![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi05g04520.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 160aa MW: 17667.1 Da PI: 7.3378 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 143 | 9.4e-45 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el
Vradi05g04520.1 10 PCAACKFLRRKCLSGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKEL 103
7********************************************************************************************* PP
DUF260 95 allke 99
+++++
Vradi05g04520.1 104 DSANA 108
99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 27.616 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.0E-43 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 160 aa Download sequence Send to blast |
MASSSSYNSP CAACKFLRRK CLSGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP 60 HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDSANADL LRYAYNDMPS 120 PSLSVPPAMT AATTIQQMPQ RSFNASEHAE LTFSVIVYD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 4e-68 | 3 | 126 | 4 | 127 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 4e-68 | 3 | 126 | 4 | 127 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00581 | DAP | Transfer from AT5G63090 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi05g04520.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015035 | 0.0 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014501082.2 | 1e-104 | LOB domain-containing protein 25-like isoform X2 | ||||
| Refseq | XP_022636285.1 | 1e-104 | LOB domain-containing protein 25-like isoform X1 | ||||
| Refseq | XP_022636286.1 | 1e-104 | LOB domain-containing protein 25-like isoform X1 | ||||
| Swissprot | Q9FML4 | 5e-73 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A1S3U4Y8 | 1e-102 | A0A1S3U4Y8_VIGRR; LOB domain-containing protein 25-like isoform X2 | ||||
| TrEMBL | A0A3Q0EYQ0 | 1e-102 | A0A3Q0EYQ0_VIGRR; LOB domain-containing protein 25-like isoform X1 | ||||
| STRING | XP_007138029.1 | 1e-97 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1091 | 34 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 2e-75 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




