![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi07g20300.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 91aa MW: 10083.8 Da PI: 10.1319 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 34.8 | 5.8e-11 | 20 | 52 | 29 | 61 |
YABBY 29 tslfkvvtvrCGhCtsllsvnlakasqllaaes 61
slf +vtvrCGhCt+l svn+a a q l+ ++
Vradi07g20300.1 20 RSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQD 52
69*********************9999888766 PP
| |||||||
| 2 | YABBY | 27 | 1.3e-08 | 74 | 90 | 118 | 134 |
YABBY 118 PPekrqrvPsaynrfik 134
PekrqrvPsayn+fik
Vradi07g20300.1 74 APEKRQRVPSAYNQFIK 90
69**************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 6.5E-10 | 20 | 52 | IPR006780 | YABBY protein |
| Pfam | PF04690 | 3.5E-6 | 72 | 90 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MLRPSNSVTS PATFAILFLR SLFDIVTVRC GHCTNLWSVN MAAAFQSLSW QDVQVRVGFV 60 GVIPFDKIEA PLVAPEKRQR VPSAYNQFIK * |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi07g20300.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 6e-54 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021275880.1 | 4e-25 | axial regulator YABBY 5-like isoform X2 | ||||
| TrEMBL | A0A4P1R292 | 2e-23 | A0A4P1R292_LUPAN; Uncharacterized protein | ||||
| TrEMBL | B9SMI2 | 2e-23 | B9SMI2_RICCO; Axial regulator YABBY5, putative | ||||
| STRING | XP_002527201.1 | 3e-24 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1124 | 34 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 1e-22 | YABBY family protein | ||||




