![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi07g25390.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 133aa MW: 15027.9 Da PI: 5.3432 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 172.2 | 5.6e-54 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
reqdr+lPianv+rimk++lP nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wala+lGf+dy++pl+ yl++yrele
Vradi07g25390.1 19 REQDRLLPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALASLGFDDYADPLRRYLHRYRELEL 112
89******************************************************************************************98 PP
NF-YB 96 ek 97
++
Vradi07g25390.1 113 DR 114
87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 8.5E-52 | 12 | 127 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.38E-39 | 21 | 129 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.8E-27 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-18 | 52 | 70 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-18 | 71 | 89 | No hit | No description |
| PRINTS | PR00615 | 1.7E-18 | 90 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MMVDNVGGSS SNPENSGIRE QDRLLPIANV GRIMKQILPP NAKISKESKE TMQECVSEFI 60 SFVTSEASEK CRKERRKTVN GDDICWALAS LGFDDYADPL RRYLHRYREL ELDRTAIQER 120 GNSPSKDKDA EF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 8e-45 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 8e-45 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi07g25390.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014506750.1 | 7e-95 | nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 1e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A1S3UL77 | 2e-93 | A0A1S3UL77_VIGRR; nuclear transcription factor Y subunit B-5-like | ||||
| STRING | XP_007154257.1 | 8e-88 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 6e-50 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




