PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vradi07g30190.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WRKY

Protein Properties

Length: 75aa MW: 8651.79 Da PI: 7.6255

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi07g30190.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	55.5	1.1e-17	16	52	23	59
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 sYYrC+++gC+vkk+++r ++d+++v++tYeg+H h+ Vradi07g30190.1 16 SYYRCSYRGCNVKKQIQRHSKDEEIVVTTYEGTHSHP 52 9***********************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00774	2.7E-8	9	53	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	6.7E-16	16	53	IPR003657	WRKY domain
PROSITE profile	PS50811	16.099	16	54	IPR003657	WRKY domain
SuperFamily	SSF118290	9.02E-14	16	53	IPR003657	WRKY domain
Pfam	PF03106	2.4E-13	16	52	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MSDLTRPVDL LAALISYYRC SYRGCNVKKQ IQRHSKDEEI VVTTYEGTHS HPVEKTTESF 60 EQILRNHHIY SLTL*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi07g30190.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015034	2e-84	AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014508459.1	8e-37	probable WRKY transcription factor 75
Swissprot	Q9FYA2	9e-23	WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBL	A0A1S3URB0	2e-35	A0A1S3URB0_VIGRR; probable WRKY transcription factor 75
STRING	GLYMA08G01430.1	3e-33	(Glycine max)
STRING	XP_007160017.1	2e-33	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF35387	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13080.1	4e-25	WRKY DNA-binding protein 75

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xu L, et al. Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Zhang S, et al. The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] Guo P, et al. A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]