![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi08g12690.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 150aa MW: 16883.2 Da PI: 4.6157 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 127.8 | 3.8e-40 | 1 | 72 | 30 | 101 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
+kadedv+misaeaPv++++ace+fileltlrsw+h+eenkr+tl+k+diaaa+trtdifdflvdivpr++
Vradi08g12690.1 1 MKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRKTLQKNDIAAAITRTDIFDFLVDIVPREDY 72
9********************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 2.8E-15 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 6.04E-24 | 1 | 69 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 6.1E-31 | 1 | 69 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 150 aa Download sequence Send to blast |
MKADEDVRMI SAEAPVIFAR ACEMFILELT LRSWNHTEEN KRKTLQKNDI AAAITRTDIF 60 DFLVDIVPRE DYKDEVLASM PRGAVPVTAP PEALPYCYMP PQHAQVGAAG VMMSNKPVMD 120 PYAQQSHQYN MAQQMWPQPP EQQQSSSDQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 2e-44 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi08g12690.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015041 | 0.0 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027933942.1 | 1e-108 | nuclear transcription factor Y subunit C-3-like | ||||
| Swissprot | Q8L4B2 | 1e-58 | NFYC9_ARATH; Nuclear transcription factor Y subunit C-9 | ||||
| Swissprot | Q9ZVL3 | 7e-59 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
| TrEMBL | A0A4D6N0P9 | 1e-106 | A0A4D6N0P9_VIGUN; Nuclear transcription factor Y | ||||
| STRING | XP_007144748.1 | 2e-99 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1257 | 34 | 108 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G08970.4 | 2e-60 | nuclear factor Y, subunit C9 | ||||




