![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi09g05300.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 151aa MW: 16450.6 Da PI: 10.0444 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 79.4 | 5.2e-25 | 86 | 134 | 1 | 49 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49
+Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsr
Vradi09g05300.1 86 RCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRL 134
6**********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 6.4E-26 | 80 | 134 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 19.828 | 84 | 150 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.55E-24 | 85 | 137 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 9.7E-19 | 87 | 134 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009554 | Biological Process | megasporogenesis | ||||
| GO:0009556 | Biological Process | microsporogenesis | ||||
| GO:0048653 | Biological Process | anther development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 151 aa Download sequence Send to blast |
MLSLDPLPHV NAANCGPGPG PGPGGLLLVP KSEDVGRPMD FVGSRIGLNL GGRTYFSSSE 60 DDFVSRLYRR SRPAESGSAA SSNSPRCQAE GCNADLSQAK HYHRRHKVCE FHSKAATVIA 120 AGLTQRFCQQ CSRLWWRLSL PHRRKININH * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-18 | 77 | 134 | 1 | 58 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00090 | SELEX | Transfer from AT1G02065 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi09g05300.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015042 | 0.0 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027906991.1 | 5e-93 | squamosa promoter-binding-like protein 8 | ||||
| Swissprot | Q8GXL3 | 7e-54 | SPL8_ARATH; Squamosa promoter-binding-like protein 8 | ||||
| TrEMBL | A0A4D6MXP2 | 1e-91 | A0A4D6MXP2_VIGUN; Transcription factor | ||||
| STRING | XP_004510109.1 | 8e-79 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6801 | 33 | 48 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G02065.2 | 7e-57 | squamosa promoter binding protein-like 8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




