![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi09g07130.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 152aa MW: 17999.7 Da PI: 10.4651 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 49 | 1.4e-15 | 4 | 53 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
r+rW +eEd ll +v+++G++ W++++++m+ ++R +k+c +rw +yl
Vradi09g07130.1 4 RQRWKAEEDALLCAYVREYGPREWNLVSHRMNtpLNRDAKSCLERWKNYL 53
89**********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 36.7 | 9.9e-12 | 59 | 96 | 1 | 40 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
+g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +
Vradi09g07130.1 59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRI 96
6788******************.*********.***9965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 22.673 | 1 | 57 | IPR017930 | Myb domain |
| SMART | SM00717 | 6.0E-13 | 3 | 55 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.14E-23 | 4 | 98 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.43E-8 | 6 | 53 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-20 | 6 | 60 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 8.6E-14 | 7 | 68 | No hit | No description |
| SMART | SM00717 | 4.0E-8 | 58 | 106 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 13.373 | 58 | 108 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-17 | 61 | 103 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.99E-6 | 63 | 96 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 152 aa Download sequence Send to blast |
MKERQRWKAE EDALLCAYVR EYGPREWNLV SHRMNTPLNR DAKSCLERWK NYLKPGIKKG 60 SLTEEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRIETEY KEQLAGLRRD AESKEQKLVE 120 EWNAKHMRVM KYMERQQVGG RIPRIDEPNG R* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 1e-17 | 7 | 104 | 7 | 101 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 4e-17 | 7 | 104 | 61 | 155 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 4e-17 | 7 | 104 | 61 | 155 | MYB PROTO-ONCOGENE PROTEIN |
| 1mse_C | 1e-17 | 7 | 104 | 7 | 101 | C-Myb DNA-Binding Domain |
| 1msf_C | 1e-17 | 7 | 104 | 7 | 101 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). Involved in leaf polarity establishment by functioning cooperatively with NUCL1 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269|PubMed:11076771, ECO:0000269|PubMed:11140682, ECO:0000269|PubMed:11882937, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976, ECO:0000269|PubMed:27334696}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi09g07130.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269|PubMed:16166385, ECO:0000269|PubMed:21950734}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015042 | 1e-139 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014515811.1 | 4e-62 | transcription factor AS1 | ||||
| Refseq | XP_014515812.1 | 4e-62 | transcription factor AS1 | ||||
| Refseq | XP_014515813.1 | 4e-62 | transcription factor AS1 | ||||
| Swissprot | O80931 | 8e-55 | AS1_ARATH; Transcription factor AS1 | ||||
| TrEMBL | A0A1S3VBT0 | 1e-60 | A0A1S3VBT0_VIGRR; transcription factor AS1 | ||||
| STRING | Gorai.012G104100.1 | 2e-59 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2597 | 33 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37630.1 | 3e-57 | MYB family protein | ||||




