![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi10g06620.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 61aa MW: 6436.25 Da PI: 7.3561 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 44.4 | 4.8e-14 | 1 | 40 | 61 | 100 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
+vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal+++e
Vradi10g06620.1 1 MVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLALAQAE 40
69**********************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 9.599 | 1 | 41 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.5E-11 | 1 | 38 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MVYEANARVR DPVYGCVGAI SSLQQQIDVL QTQLALAQAE VAHLRVRQNS GGAGGDRAPW 60 * |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi10g06620.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015038 | 2e-65 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014518102.1 | 1e-26 | LOB domain-containing protein 4 | ||||
| Refseq | XP_017435904.1 | 2e-26 | PREDICTED: LOB domain-containing protein 4-like | ||||
| Refseq | XP_027931736.1 | 1e-26 | LOB domain-containing protein 4-like | ||||
| Swissprot | Q9SHE9 | 5e-19 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
| TrEMBL | A0A0L9VDQ5 | 3e-25 | A0A0L9VDQ5_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A0S3S4E4 | 4e-25 | A0A0S3S4E4_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A1S3VIR3 | 3e-25 | A0A1S3VIR3_VIGRR; LOB domain-containing protein 4 | ||||
| TrEMBL | A0A371I1T7 | 5e-25 | A0A371I1T7_MUCPR; LOB domain-containing protein 4 (Fragment) | ||||
| STRING | Lus10040638 | 9e-26 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1334 | 34 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31320.1 | 2e-21 | LOB domain-containing protein 4 | ||||




