![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vradi11g04790.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 148aa MW: 16605.8 Da PI: 7.9545 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 82.9 | 4.5e-26 | 10 | 68 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+ye+++d+ ++e+isws++gn+fvv+++ ef+k++Lpk Fkh+nf+SFvRQLn+Y
Vradi11g04790.1 10 FLTKTYELVDDPGTNEVISWSDTGNTFVVWKHAEFSKDLLPKCFKHNNFSSFVRQLNTY 68
9********************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.5E-27 | 3 | 69 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 7.8E-26 | 6 | 123 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.79E-23 | 7 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 1.7E-15 | 10 | 33 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 3.4E-22 | 10 | 72 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.7E-15 | 48 | 60 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.7E-15 | 61 | 73 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MSQRSVPAPF LTKTYELVDD PGTNEVISWS DTGNTFVVWK HAEFSKDLLP KCFKHNNFSS 60 FVRQLNTYMR QGSCGSEKAV GEEGGGECLK LFGVWLKEDT LADKRNNNHK RAREDQMGFG 120 GPRLKESKPV VDFEPINLIM TSNKVCN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 1e-19 | 5 | 86 | 16 | 90 | Heat shock factor protein 1 |
| 5hdg_A | 9e-20 | 6 | 86 | 7 | 80 | Heat shock factor protein 1 |
| 5hdn_A | 9e-20 | 6 | 86 | 7 | 80 | Heat shock factor protein 1 |
| 5hdn_B | 9e-20 | 6 | 86 | 7 | 80 | Heat shock factor protein 1 |
| 5hdn_C | 9e-20 | 6 | 86 | 7 | 80 | Heat shock factor protein 1 |
| 5hdn_D | 9e-20 | 6 | 86 | 7 | 80 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Vradi11g04790.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015043 | 1e-120 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014519942.1 | 2e-51 | heat shock factor protein HSF24 | ||||
| Refseq | XP_022631341.1 | 2e-51 | heat shock factor protein HSF24 | ||||
| TrEMBL | A0A1S3VP28 | 5e-50 | A0A1S3VP28_VIGRR; heat shock factor protein HSF24 | ||||
| STRING | XP_007156806.1 | 3e-47 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36990.1 | 8e-33 | heat shock factor 4 | ||||




