PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vun006552

Organism

Vigna unguiculata

Taxonomic ID

3917

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NF-YB

Protein Properties

Length: 129aa MW: 14400.4 Da PI: 6.2666

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Vun#S45803954	PU_unref	Unigene	View CDS
PUT-167a-Vigna_unguiculata-15711	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	182.4	3.8e-57	19	114	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdr+lPianv+rimkkvlP+nakisk++ket+qecvsefisfvt+easdkcq+ekrktingddllwa+a+lGfedy+eplk+yl+kyre+egek Vun006552 19 REQDRLLPIANVGRIMKKVLPGNAKISKESKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMASLGFEDYAEPLKAYLHKYREMEGEK 114 89********************************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.8E-53	14	117	IPR009072	Histone-fold
SuperFamily	SSF47113	2.33E-41	21	124	IPR009072	Histone-fold
Pfam	PF00808	9.4E-28	24	88	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	9.0E-22	52	70	No hit	No description
PROSITE pattern	PS00685	0	55	71	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	9.0E-22	71	89	No hit	No description
PRINTS	PR00615	9.0E-22	90	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 129 aa Download sequence Send to blast
MAESDNESGG GKNESSICRE QDRLLPIANV GRIMKKVLPG NAKISKESKE TMQECVSEFI 60 SFVTGEASDK CQKEKRKTIN GDDLLWAMAS LGFEDYAEPL KAYLHKYREM EGEKTAMIGK 120 HHGLYANPL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-47	19	109	2	92	Transcription factor HapC (Eurofung)
4g92_B	2e-47	19	109	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027917771.1	1e-92	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	4e-64	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A4D6KZS7	2e-91	A0A4D6KZS7_VIGUN; Nuclear transcription factor Y
STRING	XP_007154047.1	1e-88	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-66	nuclear factor Y, subunit B3

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]