PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vun006629

Organism

Vigna unguiculata

Taxonomic ID

3917

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

TALE

Protein Properties

Length: 123aa MW: 14495.7 Da PI: 10.046

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Vun#S45819937	PU_unref	Unigene	View CDS
PUT-167a-Vigna_unguiculata-21383	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	30.5	6e-10	64	98	21	55
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp++ee+ +L++ +gL+++q+ +WF N+R ++ Vun006629 64 RWPYPTEEEKVKLSEVTGLDQKQINNWFINQRKRH 98 468*****************************985 PP
2	ELK	32.1	2.5e-11	19	39	2	22
ELK 2 LKhqLlrKYsgyLgsLkqEFs 22 LK++LlrKYsg+ ++L++EF+ Vun006629 19 LKEMLLRKYSGHFSGLRKEFL 39 9*******************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01188	2.1E-5	18	39	IPR005539	ELK domain
PROSITE profile	PS51213	9.795	18	38	IPR005539	ELK domain
Pfam	PF03789	2.5E-9	19	39	IPR005539	ELK domain
PROSITE profile	PS50071	12.568	38	101	IPR001356	Homeobox domain
SuperFamily	SSF46689	4.02E-20	40	113	IPR009057	Homeodomain-like
SMART	SM00389	8.1E-14	40	105	IPR001356	Homeobox domain
CDD	cd00086	1.60E-13	41	101	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.7E-26	43	103	IPR009057	Homeodomain-like
Pfam	PF05920	9.6E-17	58	97	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	76	99	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 123 aa Download sequence Send to blast
MEEVEDHISS LSCPGDQNLK EMLLRKYSGH FSGLRKEFLK RRKKGKLPKD AKMALMDWWN 60 THHRWPYPTE EEKVKLSEVT GLDQKQINNW FINQRKRHWK PTEDMRFAVM DGLSGGAGGA 120 MFF

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027942186.1	4e-88	homeobox protein knotted-1-like 1 isoform X1
Refseq	XP_027942194.1	4e-88	homeobox protein knotted-1-like 1 isoform X2
Swissprot	A2Y007	3e-48	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	3e-48	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	A0A4D6MF40	9e-87	A0A4D6MF40_VIGUN; Pre-B-cell leukemia transcription factor
STRING	GLYMA03G39041.2	9e-71	(Glycine max)
STRING	GLYMA19G41610.3	1e-70	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23380.1	4e-42	KNOTTED1-like homeobox gene 6

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]