PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun011599
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WRKY
Protein Properties Length: 138aa    MW: 15454.2 Da    PI: 6.1393
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S45852044PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY30.19.9e-102313059
               TT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY 30 agCpvkkkversaedpkvveitYegeHnhe 59
               +gC ++k+vers+ dp v+ +tY+ eH h+
  Vun011599  2 KGCLARKQVERSHLDPAVFLVTYTAEHSHP 31
               68***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007747.8E-4132IPR003657WRKY domain
PROSITE profilePS5081114.561133IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.6E-8233IPR003657WRKY domain
SuperFamilySSF1182902.62E-7233IPR003657WRKY domain
PfamPF031061.0E-6231IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
SKGCLARKQV ERSHLDPAVF LVTYTAEHSH PHPTRRNSLA GTTRKNNSLI PPPTTRNHNT  60
TCSSRTPLMV QSIEEKLVTS VQQSMDLKKE EDFLEWFDDD GAQFGDAWIP TSDLEKLIGL  120
ECQHFALDGG FTDGYAHS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the expression of defense genes in innate immune response of plants. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Activates WRKY 29, SIRK and its own promoters. {ECO:0000269|PubMed:11875555}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced after flagellin treatment. {ECO:0000269|PubMed:11875555}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027918161.14e-99probable WRKY transcription factor 29
SwissprotO046092e-18WRK22_ARATH; WRKY transcription factor 22
TrEMBLA0A4D6L9788e-98A0A4D6L978_VIGUN; WRKY transcription factor 29
STRINGXP_007160109.14e-76(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01250.16e-21WRKY family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Coego A, et al.
    The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression.
    Plant J., 2014. 77(6): p. 944-53
    [PMID:24456507]
  3. Gkizi D, et al.
    The Innate Immune Signaling System as a Regulator of Disease Resistance and Induced Systemic Resistance Activity Against Verticillium dahliae.
    Mol. Plant Microbe Interact., 2016. 29(4): p. 313-23
    [PMID:26780421]
  4. Kloth KJ, et al.
    AtWRKY22 promotes susceptibility to aphids and modulates salicylic acid and jasmonic acid signalling.
    J. Exp. Bot., 2016. 67(11): p. 3383-96
    [PMID:27107291]
  5. Camborde L, et al.
    Detection of nucleic acid-protein interactions in plant leaves using fluorescence lifetime imaging microscopy.
    Nat Protoc, 2017. 12(9): p. 1933-1950
    [PMID:28837131]
  6. Wang S, et al.
    Bacillus cereus AR156 Activates Defense Responses to Pseudomonas syringae pv. tomato in Arabidopsis thaliana Similarly to flg22.
    Mol. Plant Microbe Interact., 2018. 31(3): p. 311-322
    [PMID:29090631]