PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vun011599

Organism

Vigna unguiculata

Taxonomic ID

3917

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WRKY

Protein Properties

Length: 138aa MW: 15454.2 Da PI: 6.1393

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Vun#S45852044	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	30.1	9.9e-10	2	31	30	59
TT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 30 agCpvkkkversaedpkvveitYegeHnhe 59 +gC ++k+vers+ dp v+ +tY+ eH h+ Vun011599 2 KGCLARKQVERSHLDPAVFLVTYTAEHSHP 31 68***************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00774	7.8E-4	1	32	IPR003657	WRKY domain
PROSITE profile	PS50811	14.561	1	33	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	4.6E-8	2	33	IPR003657	WRKY domain
SuperFamily	SSF118290	2.62E-7	2	33	IPR003657	WRKY domain
Pfam	PF03106	1.0E-6	2	31	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 138 aa Download sequence Send to blast
SKGCLARKQV ERSHLDPAVF LVTYTAEHSH PHPTRRNSLA GTTRKNNSLI PPPTTRNHNT 60 TCSSRTPLMV QSIEEKLVTS VQQSMDLKKE EDFLEWFDDD GAQFGDAWIP TSDLEKLIGL 120 ECQHFALDGG FTDGYAHS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the expression of defense genes in innate immune response of plants. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Activates WRKY 29, SIRK and its own promoters. {ECO:0000269\|PubMed:11875555}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced after flagellin treatment. {ECO:0000269\|PubMed:11875555}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027918161.1	4e-99	probable WRKY transcription factor 29
Swissprot	O04609	2e-18	WRK22_ARATH; WRKY transcription factor 22
TrEMBL	A0A4D6L978	8e-98	A0A4D6L978_VIGUN; WRKY transcription factor 29
STRING	XP_007160109.1	4e-76	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G01250.1	6e-21	WRKY family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Gkizi D, et al. The Innate Immune Signaling System as a Regulator of Disease Resistance and Induced Systemic Resistance Activity Against Verticillium dahliae. Mol. Plant Microbe Interact., 2016. 29(4): p. 313-23 [PMID:26780421] Kloth KJ, et al. AtWRKY22 promotes susceptibility to aphids and modulates salicylic acid and jasmonic acid signalling. J. Exp. Bot., 2016. 67(11): p. 3383-96 [PMID:27107291] Camborde L, et al. Detection of nucleic acid-protein interactions in plant leaves using fluorescence lifetime imaging microscopy. Nat Protoc, 2017. 12(9): p. 1933-1950 [PMID:28837131] Wang S, et al. Bacillus cereus AR156 Activates Defense Responses to Pseudomonas syringae pv. tomato in Arabidopsis thaliana Similarly to flg22. Mol. Plant Microbe Interact., 2018. 31(3): p. 311-322 [PMID:29090631]