![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| TF ID | Vun012130 | ||||||||||||
| Organism | |||||||||||||
| Taxonomic ID | |||||||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||||||
| Family | MYB_related | ||||||||||||
| Protein Properties | Length: 80aa MW: 9310.67 Da PI: 8.9116 | ||||||||||||
| Description | MYB_related family protein | ||||||||||||
| Gene Model |
|
||||||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.6 | 4.5e-11 | 5 | 34 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+++WT++E++ l+ +v+++G+g Wk I +
Vun012130 5 KQKWTQDEEDALIAGVEKHGPGKWKNILKD 34
79*************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 9.686 | 1 | 53 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.96E-11 | 2 | 68 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.3E-8 | 5 | 33 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-11 | 5 | 36 | IPR009057 | Homeodomain-like |
| CDD | cd11660 | 1.93E-12 | 6 | 50 | No hit | No description |
| Gene3D | G3DSA:2.60.120.10 | 9.3E-7 | 50 | 79 | IPR014710 | RmlC-like jelly roll fold |
| Pfam | PF05899 | 3.6E-7 | 50 | 78 | IPR008579 | Domain of unknown function DUF861, cupin-3 |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MGNQKQKWTQ DEEDALIAGV EKHGPGKWKN ILKDPQFAPF LTSHSNIDLK MGMPQGKFPW 60 SYEEKETYYL VEGKVKVWVK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds preferentially double-stranded telomeric repeats. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006583000.1 | 9e-29 | telomere repeat-binding factor 4 isoform X2 | ||||
| Refseq | XP_020986124.1 | 3e-29 | telomere repeat-binding factor 4-like | ||||
| Refseq | XP_020986125.1 | 3e-29 | telomere repeat-binding factor 4-like | ||||
| Refseq | XP_020986126.1 | 3e-29 | telomere repeat-binding factor 4-like | ||||
| Refseq | XP_020986127.1 | 3e-29 | telomere repeat-binding factor 4-like | ||||
| Refseq | XP_028238774.1 | 9e-29 | telomere repeat-binding factor 4-like isoform X2 | ||||
| Swissprot | F4I7L1 | 1e-19 | TRB4_ARATH; Telomere repeat-binding factor 4 | ||||
| TrEMBL | A0A4D6NBT5 | 5e-41 | A0A4D6NBT5_VIGUN; Myb proto-oncogene protein | ||||
| STRING | GLYMA07G00930.1 | 6e-28 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G17520.1 | 4e-22 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




