PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00001288-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

NF-YB

Protein Properties

Length: 76aa MW: 8620.7 Da PI: 4.345

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00001288-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	57.2	4e-18	27	63	3	39
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecv 39 eqdrflPianvs+imkk+lP n+kiskdaket+q+cv WALNUT_00001288-RA 27 EQDRFLPIANVSQIMKKALPVNTKISKDAKETMQKCV 63 8***********************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.5E-16	25	63	IPR009072	Histone-fold
SuperFamily	SSF47113	3.26E-11	28	64	IPR009072	Histone-fold
Pfam	PF00808	5.0E-11	31	63	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
MEDLDNESEG GDERARNTST NELSPWEQDR FLPIANVSQI MKKALPVNTK ISKDAKETMQ 60 KCVWLVDEIG VVVKNE

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018838144.1	1e-30	PREDICTED: nuclear transcription factor Y subunit B-8-like
Swissprot	Q75IZ7	5e-19	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A2I4G2L3	3e-29	A0A2I4G2L3_JUGRE; nuclear transcription factor Y subunit B-8-like
STRING	evm.model.supercontig_12.151	4e-22	(Carica papaya)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	3e-21	nuclear factor Y, subunit B3

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958]