![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00001601-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 67aa MW: 7799.9 Da PI: 10.165 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.9 | 1.1e-13 | 11 | 56 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+g+W +eEde l++ vk++G+g+W++I + + R +k+c++rw +
WALNUT_00001601-RA 11 KGPWKAEEDEVLLNHVKRYGPGDWSSIRSNGLLQRMGKSCRLRWVN 56
79************************98776699**********87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.8E-21 | 6 | 61 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 18.726 | 6 | 62 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.18E-16 | 7 | 62 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.1E-9 | 10 | 60 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.4E-12 | 11 | 56 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.18E-9 | 13 | 58 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 67 aa Download sequence Send to blast |
MEGYGDEGIR KGPWKAEEDE VLLNHVKRYG PGDWSSIRSN GLLQRMGKSC RLRWVNKLRP 60 NFWGVPQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269|PubMed:15618418, ECO:0000269|PubMed:15694308, ECO:0000269|PubMed:19300502, ECO:0000269|PubMed:21285328, ECO:0000269|PubMed:24876252}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269|PubMed:21441434, ECO:0000269|PubMed:25057814}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018854309.1 | 6e-33 | PREDICTED: transcription factor MYB57 isoform X1 | ||||
| Swissprot | A0A178VEK7 | 9e-29 | DUO1_ARATH; Transcription factor DUO1 | ||||
| TrEMBL | A0A2I4HDR6 | 1e-31 | A0A2I4HDR6_JUGRE; transcription factor MYB57 isoform X1 | ||||
| STRING | XP_009345055.1 | 1e-29 | (Pyrus x bretschneideri) | ||||
| STRING | XP_004289595.1 | 1e-29 | (Fragaria vesca) | ||||
| STRING | XP_004308519.1 | 2e-29 | (Fragaria vesca) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60460.1 | 3e-31 | MYB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




