PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00001840-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

Protein Properties

Length: 59aa MW: 6833.02 Da PI: 10.6814

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00001840-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	35	2.5e-11	20	56	40	76
ETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--T CS B3 40 desgrsWevkliyrkksgryvltkGWkeFvkangLke 76 d+s r ++ ++y+k+s+++v+t+GW++Fv++n Lk WALNUT_00001840-RA 20 DRSMRICKFLHCYWKSSQSFVFTRGWNRFVNENPLKP 56 688999***************************9985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101936	1.04E-9	19	55	IPR015300	DNA-binding pseudobarrel domain
Gene3D	G3DSA:2.40.330.10	4.2E-9	20	55	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	6.9E-9	20	56	IPR003340	B3 DNA binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MHKGPGTMEA ARVLLTLSCD RSMRICKFLH CYWKSSQSFV FTRGWNRFVN ENPLKPKAG

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018850320.1	4e-14	PREDICTED: AP2/ERF and B3 domain-containing transcription factor At1g50680-like
Refseq	XP_018850321.1	4e-14	PREDICTED: AP2/ERF and B3 domain-containing transcription factor At1g50680-like
Refseq	XP_018850322.1	4e-14	PREDICTED: AP2/ERF and B3 domain-containing transcription factor At1g50680-like
Refseq	XP_018850323.1	4e-14	PREDICTED: AP2/ERF and B3 domain-containing transcription factor At1g50680-like
Refseq	XP_018850324.1	4e-14	PREDICTED: AP2/ERF and B3 domain-containing transcription factor At1g50680-like

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G50680.1	7e-16	RAV family protein