![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00003522-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 71aa MW: 8317.22 Da PI: 5.6201 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 100.7 | 1.1e-31 | 1 | 61 | 35 | 95 |
NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+q+cvsefisfvt+eas+kc++e+rkt+ngdd++wal tlGf++y+ p+k yl++y e ++
WALNUT_00003522-RA 1 MQDCVSEFISFVTCEASEKCRKERRKTVNGDDVCWALETLGFDEYAGPMKRYLHRYSEHDQ 61
79******************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 3.53E-22 | 1 | 67 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.3E-28 | 1 | 68 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 2.0E-15 | 1 | 19 | No hit | No description |
| Pfam | PF00808 | 1.4E-12 | 1 | 37 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PROSITE pattern | PS00685 | 0 | 4 | 20 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.0E-15 | 20 | 38 | No hit | No description |
| PRINTS | PR00615 | 2.0E-15 | 39 | 57 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MQDCVSEFIS FVTCEASEKC RKERRKTVNG DDVCWALETL GFDEYAGPMK RYLHRYSEHD 60 QADHRANQEK G |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 6e-23 | 1 | 58 | 36 | 93 | NF-YB |
| 4awl_B | 7e-23 | 1 | 58 | 37 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 7e-23 | 1 | 58 | 37 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018840391.1 | 1e-48 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 8e-28 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A2I4G918 | 2e-47 | A0A2I4G918_JUGRE; nuclear transcription factor Y subunit B-5-like | ||||
| STRING | XP_006489109.1 | 1e-32 | (Citrus sinensis) | ||||
| STRING | EOY06479 | 1e-32 | (Theobroma cacao) | ||||
| STRING | XP_006419612.1 | 1e-32 | (Citrus clementina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 3e-30 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




