PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00007142-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

MYB_related

Protein Properties

Length: 93aa MW: 10863.6 Da PI: 8.9542

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00007142-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.8	1.2e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +++++G g+W++ ++ g+ R++k+c++rw +yl WALNUT_00007142-RA 14 KGPWTPEEDQILITYIQLYGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61 79****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.6E-27	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.287	9	65	IPR017930	Myb domain
SMART	SM00717	3.4E-15	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-17	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.24E-25	15	92	IPR009057	Homeodomain-like
CDD	cd00167	2.89E-12	16	61	No hit	No description
PROSITE profile	PS50090	4.449	62	93	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	6.4E-9	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MVRAPCCEKM GLKKGPWTPE EDQILITYIQ LYGHGNWRAL PKQAGLLRCG KSCRLRWTNY 60 LRPDIKRGNF SREEEDAIIN LHEMLGNRSV YID

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	5e-17	12	92	25	104	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018818400.1	1e-62	PREDICTED: myb-related protein Myb4-like
Refseq	XP_018822907.1	5e-65	PREDICTED: myb-related protein Myb4-like
Swissprot	Q9LTC4	1e-53	MYB15_ARATH; Transcription factor MYB15
TrEMBL	A0A2I4EG80	3e-61	A0A2I4EG80_JUGRE; myb-related protein Myb4-like
TrEMBL	A0A2I4EU50	1e-63	A0A2I4EU50_JUGRE; myb-related protein Myb4-like
STRING	XP_006479545.1	2e-57	(Citrus sinensis)
STRING	EOX94461	1e-57	(Theobroma cacao)
STRING	XP_006443843.1	2e-57	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G23250.1	5e-56	myb domain protein 15

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]