![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00009520-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 103aa MW: 12017.8 Da PI: 10.0456 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 62.1 | 1.4e-19 | 21 | 83 | 2 | 65 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65
F +kl ++++++e+++++sws+++nsfvv+++ efa+k+Lpk+Fkh+n+aSF + n Y+F+++
WALNUT_00009520-RA 21 FFRKLCSMVDKPETESMVSWSDDNNSFVVWNPYEFASKLLPKHFKHKNLASFKHK-NPYEFTSI 83
899*************************************************765.99999876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 4.3E-20 | 12 | 84 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.1E-9 | 17 | 99 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 6.67E-18 | 19 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 8.4E-8 | 21 | 44 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 6.9E-16 | 21 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 8.4E-8 | 59 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MANVNDVGSS TTTTKDTLPL FFRKLCSMVD KPETESMVSW SDDNNSFVVW NPYEFASKLL 60 PKHFKHKNLA SFKHKNPYEF TSIVALIKYF QQMHASKRRP FHT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 3e-13 | 18 | 84 | 26 | 93 | Heat shock factor protein 1 |
| 5d5v_B | 3e-13 | 18 | 84 | 26 | 93 | Heat shock factor protein 1 |
| 5d5v_D | 3e-13 | 18 | 84 | 26 | 93 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018829016.1 | 3e-35 | PREDICTED: heat stress transcription factor A-1b-like | ||||
| Refseq | XP_018829017.1 | 3e-35 | PREDICTED: heat stress transcription factor A-1b-like | ||||
| Swissprot | Q7XRX3 | 4e-16 | HFB2A_ORYSJ; Heat stress transcription factor B-2a | ||||
| Swissprot | Q9SCW5 | 6e-16 | HFA1E_ARATH; Heat stress transcription factor A-1e | ||||
| TrEMBL | A0A2I4FBJ6 | 6e-34 | A0A2I4FBJ6_JUGRE; heat stress transcription factor A-1b-like | ||||
| STRING | GLYMA16G13400.1 | 2e-16 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02990.1 | 2e-18 | heat shock transcription factor A1E | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




