PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00009520-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

HSF

Protein Properties

Length: 103aa MW: 12017.8 Da PI: 10.0456

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00009520-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	62.1	1.4e-19	21	83	2	65
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65 F +kl ++++++e+++++sws+++nsfvv+++ efa+k+Lpk+Fkh+n+aSF + n Y+F+++ WALNUT_00009520-RA 21 FFRKLCSMVDKPETESMVSWSDDNNSFVVWNPYEFASKLLPKHFKHKNLASFKHK-NPYEFTSI 83 899*************************************************765.99999876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	4.3E-20	12	84	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.1E-9	17	99	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	6.67E-18	19	86	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	8.4E-8	21	44	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	6.9E-16	21	84	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	8.4E-8	59	71	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MANVNDVGSS TTTTKDTLPL FFRKLCSMVD KPETESMVSW SDDNNSFVVW NPYEFASKLL 60 PKHFKHKNLA SFKHKNPYEF TSIVALIKYF QQMHASKRRP FHT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	3e-13	18	84	26	93	Heat shock factor protein 1
5d5v_B	3e-13	18	84	26	93	Heat shock factor protein 1
5d5v_D	3e-13	18	84	26	93	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018829016.1	3e-35	PREDICTED: heat stress transcription factor A-1b-like
Refseq	XP_018829017.1	3e-35	PREDICTED: heat stress transcription factor A-1b-like
Swissprot	Q7XRX3	4e-16	HFB2A_ORYSJ; Heat stress transcription factor B-2a
Swissprot	Q9SCW5	6e-16	HFA1E_ARATH; Heat stress transcription factor A-1e
TrEMBL	A0A2I4FBJ6	6e-34	A0A2I4FBJ6_JUGRE; heat stress transcription factor A-1b-like
STRING	GLYMA16G13400.1	2e-16	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G02990.1	2e-18	heat shock transcription factor A1E

Publications ? help Back to Top
Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]