![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00011542-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 96aa MW: 10449.6 Da PI: 8.7029 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 105 | 4.8e-33 | 28 | 84 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY eC+kNhAa++Gg+avDGC+Efm+s ge+g+ al CaACgCHRnFHRreve+e
WALNUT_00011542-RA 28 TVRYAECQKNHAANIGGYAVDGCREFMAS-GEDGSNGALSCAACGCHRNFHRREVETE 84
79**************************9.999*********************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04770 | 3.8E-30 | 29 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 6.8E-27 | 30 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 7.0E-27 | 31 | 93 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.679 | 31 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MKKRQVVVKK DCSSGRSSST TSSSVVRTVR YAECQKNHAA NIGGYAVDGC REFMASGEDG 60 SNGALSCAAC GCHRNFHRRE VETEVVCEYS PPNSRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018826541.1 | 5e-65 | PREDICTED: mini zinc finger protein 3-like | ||||
| Swissprot | Q2Q493 | 1e-40 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
| TrEMBL | A0A2I4F4G1 | 1e-63 | A0A2I4F4G1_JUGRE; mini zinc finger protein 3-like | ||||
| STRING | XP_002514762.1 | 5e-53 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1550 | 34 | 100 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18835.1 | 3e-38 | mini zinc finger | ||||




