PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00013406-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

NAC

Protein Properties

Length: 171aa MW: 19746.4 Da PI: 9.9883

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00013406-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	143.3	1.3e-44	24	149	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 ppG+rF Ptdeel+v+yL+kk+ +++l++ + i ev++y ++P L +k+k +e+++y F++rd+ky++g+r+nra+ +gyWkatg d + WALNUT_00013406-RA 24 PPGYRFLPTDEELIVFYLEKKAWNQPLPI-NNIVEVNLYAHNPDFLAAKYKDyQEDQLYIFTPRDRKYRNGRRPNRAAGDGYWKATGADMK 113 8**************************.78**********965555366699***************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++s kg++vg +k Lvfy g+apkg+kt+W+mhe+r+ WALNUT_00013406-RA 114 IKS-KGTVVGYRKALVFYIGKAPKGKKTNWIMHEFRV 149 .999***************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.44E-51	16	156	IPR003441	NAC domain
PROSITE profile	PS51005	45.145	23	170	IPR003441	NAC domain
Pfam	PF02365	4.1E-23	24	149	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 171 aa Download sequence Send to blast
MEVESGNFNS NNKTKEQAGF FNKPPGYRFL PTDEELIVFY LEKKAWNQPL PINNIVEVNL 60 YAHNPDFLAA KYKDYQEDQL YIFTPRDRKY RNGRRPNRAA GDGYWKATGA DMKIKSKGTV 120 VGYRKALVFY IGKAPKGKKT NWIMHEFRVE DSPCSGRGSN GMRVCSFSSF Y

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	5e-45	21	149	15	142	NO APICAL MERISTEM PROTEIN
1ut4_B	5e-45	21	149	15	142	NO APICAL MERISTEM PROTEIN
1ut7_A	5e-45	21	149	15	142	NO APICAL MERISTEM PROTEIN
1ut7_B	5e-45	21	149	15	142	NO APICAL MERISTEM PROTEIN
3swm_A	5e-45	21	162	18	157	NAC domain-containing protein 19
3swm_B	5e-45	21	162	18	157	NAC domain-containing protein 19
3swm_C	5e-45	21	162	18	157	NAC domain-containing protein 19
3swm_D	5e-45	21	162	18	157	NAC domain-containing protein 19
3swp_A	5e-45	21	162	18	157	NAC domain-containing protein 19
3swp_B	5e-45	21	162	18	157	NAC domain-containing protein 19
3swp_C	5e-45	21	162	18	157	NAC domain-containing protein 19
3swp_D	5e-45	21	162	18	157	NAC domain-containing protein 19
4dul_A	5e-45	21	149	15	142	NAC domain-containing protein 19
4dul_B	5e-45	21	149	15	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in stress response. {ECO:0000250\|UniProtKB:Q7F2L3}.
UniProt	Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269\|PubMed:22278768}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269\|PubMed:18813954, ECO:0000269\|PubMed:20632034}.
UniProt	INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269\|PubMed:18813954}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018825363.1	1e-113	PREDICTED: NAC domain-containing protein 71-like
Swissprot	Q52QH4	1e-46	NAC68_ORYSJ; NAC domain-containing protein 68
Swissprot	Q8H4S4	2e-46	NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBL	A0A2I4F134	1e-112	A0A2I4F134_JUGRE; NAC domain-containing protein 71-like
STRING	XP_008227355.1	7e-67	(Prunus mume)
STRING	EMJ15685	3e-68	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF10112	16	42

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	2e-47	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Taga Y, et al. Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4. Plant Signal Behav, 2009. 4(8): p. 740-2 [PMID:19820348] Xia N, et al. Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses. Mol. Biol. Rep., 2010. 37(8): p. 3703-12 [PMID:20213512] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634] Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice. Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60 [PMID:26766411]