PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00014048-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

NAC

Protein Properties

Length: 144aa MW: 16608 Da PI: 9.9647

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00014048-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	89.9	4.5e-28	32	109	50	127
NAM 50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 +v ++++ew+fFs r +ky++g++++rat+ gyWkatg++++ + +++++g+k+tLvf++grapkge+t+W+mhey WALNUT_00014048-RA 32 SVIQSDNEWFFFSARGRKYPNGSQSRRATELGYWKATGRKERNEKFGSNVIGTKRTLVFHTGRAPKGERTEWIMHEYY 109 4445789******************************9988888*****************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	27.536	1	135	IPR003441	NAC domain
Pfam	PF02365	2.7E-14	31	109	IPR003441	NAC domain
SuperFamily	SSF101941	1.02E-27	34	115	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 144 aa Download sequence Send to blast
MCYNWVQILD EPLFLPGLSY LFVLENLQTA KSVIQSDNEW FFFSARGRKY PNGSQSRRAT 60 ELGYWKATGR KERNEKFGSN VIGTKRTLVF HTGRAPKGER TEWIMHEYYC MTGIAQVLGD 120 AWLRRKLVAC GGTTIAYGNK ENLR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-20	37	108	70	140	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-20	37	108	70	140	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-20	37	108	70	140	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-20	37	108	70	140	NO APICAL MERISTEM PROTEIN
3swm_A	3e-20	37	108	73	143	NAC domain-containing protein 19
3swm_B	3e-20	37	108	73	143	NAC domain-containing protein 19
3swm_C	3e-20	37	108	73	143	NAC domain-containing protein 19
3swm_D	3e-20	37	108	73	143	NAC domain-containing protein 19
3swp_A	3e-20	37	108	73	143	NAC domain-containing protein 19
3swp_B	3e-20	37	108	73	143	NAC domain-containing protein 19
3swp_C	3e-20	37	108	73	143	NAC domain-containing protein 19
3swp_D	3e-20	37	108	73	143	NAC domain-containing protein 19
4dul_A	3e-20	37	108	70	140	NAC domain-containing protein 19
4dul_B	3e-20	37	108	70	140	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in plant cell division. {ECO:0000269\|PubMed:16803883}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018831278.1	6e-49	PREDICTED: NAC domain-containing protein 60-like
Swissprot	Q94F58	4e-40	NAC89_ARATH; NAC domain-containing protein 89
TrEMBL	A0A2I4FI08	1e-47	A0A2I4FI08_JUGRE; NAC domain-containing protein 60-like
STRING	POPTR_0009s16290.1	1e-45	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF32362	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G22290.1	2e-42	NAC domain containing protein 89

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]