![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00018444-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 136aa MW: 15470 Da PI: 4.5276 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 159.8 | 4e-50 | 4 | 98 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
eq+r+lPianv+rimk++lPa akisk+aket+qec +efisfvt+easdkc++e+rkt+ngdd++wal+tlGf++y e++ yl kyre+e+
WALNUT_00018444-RA 4 EQERLLPIANVGRIMKQILPATAKISKEAKETLQECSTEFISFVTAEASDKCHKENRKTVNGDDICWALSTLGFDNYSEAMVRYLYKYREAER 96
89******************************************************************************************9 PP
NF-YB 96 ek 97
+k
WALNUT_00018444-RA 97 QK 98
86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.3E-50 | 3 | 132 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.04E-38 | 5 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.1E-26 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 9.1E-18 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 9.1E-18 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 9.1E-18 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MDDEQERLLP IANVGRIMKQ ILPATAKISK EAKETLQECS TEFISFVTAE ASDKCHKENR 60 KTVNGDDICW ALSTLGFDNY SEAMVRYLYK YREAERQKPD QNKAGSSNPD QDKQQLEESN 120 YGNDQLGKQN NEDPSS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018845882.1 | 1e-98 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O04027 | 2e-55 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A2I4GPR2 | 2e-97 | A0A2I4GPR2_JUGRE; nuclear transcription factor Y subunit B-4-like | ||||
| STRING | cassava4.1_026425m | 9e-65 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 1e-57 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




