![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00019528-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 99aa MW: 10862.3 Da PI: 4.5703 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 88.5 | 7.3e-28 | 25 | 73 | 1 | 49 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49
vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tse
WALNUT_00019528-RA 25 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSE 73
69*********************************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.0E-26 | 20 | 73 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.87E-17 | 21 | 73 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.8E-17 | 31 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MADAPTSPNG GGSLESGEQS PRSNVREQDR FLPIANISRI MKKALPANGK IAKDAKETVQ 60 ECVSEFISFI TSEYEIDDLL FFNLLLVLFV SFGYNRCGG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-21 | 25 | 73 | 1 | 49 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-21 | 25 | 73 | 1 | 49 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018807843.1 | 1e-45 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_018807844.1 | 1e-45 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| Swissprot | Q8VYK4 | 1e-31 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A2I4DL09 | 3e-44 | A0A2I4DL09_JUGRE; nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| TrEMBL | A0A2I4DL24 | 2e-44 | A0A2I4DL24_JUGRE; nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| STRING | XP_008442637.1 | 5e-41 | (Cucumis melo) | ||||
| STRING | XP_004137802.1 | 5e-41 | (Cucumis sativus) | ||||
| STRING | XP_004169107.1 | 2e-41 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF21273 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 9e-34 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




