PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00022062-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

M-type_MADS

Protein Properties

Length: 73aa MW: 8142.65 Da PI: 10.8148

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00022062-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	83.7	1.2e-26	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKK ELS+LCdaeva++ifs++gk y ++s WALNUT_00022062-RA 9 KRIENPTSRQVTFSKRRNGLLKKSLELSILCDAEVAILIFSPSGKAYQFAS 59 79**********************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.6E-38	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.132	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	9.29E-29	2	65	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.91E-35	2	66	No hit	No description
PRINTS	PR00404	1.2E-29	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.4E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-29	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
MGRGKVELKR IENPTSRQVT FSKRRNGLLK KSLELSILCD AEVAILIFSP SGKAYQFASH 60 ELVSIIIISL LRA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	9e-20	1	67	1	67	MEF2 CHIMERA
6byy_B	9e-20	1	67	1	67	MEF2 CHIMERA
6byy_C	9e-20	1	67	1	67	MEF2 CHIMERA
6byy_D	9e-20	1	67	1	67	MEF2 CHIMERA
6bz1_A	9e-20	1	67	1	67	MEF2 CHIMERA
6bz1_B	9e-20	1	67	1	67	MEF2 CHIMERA
6bz1_C	9e-20	1	67	1	67	MEF2 CHIMERA
6bz1_D	9e-20	1	67	1	67	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM190073	3e-92	KM190073.1 Carya cathayensis MADS-like protein (TM) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018828586.1	4e-37	PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1
Refseq	XP_018828657.1	4e-37	PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
Swissprot	P0C5B2	2e-28	MAD56_ORYSJ; MADS-box transcription factor 56
TrEMBL	A0A097C262	7e-36	A0A097C262_9ROSI; MADS-like protein
STRING	XP_008466902.1	8e-35	(Cucumis melo)
STRING	Migut.D01274.1.p	2e-34	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	5e-30	AGAMOUS-like 20

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Bai Z, et al. The impact and origin of copy number variations in the Oryza species. BMC Genomics, 2016. 17: p. 261 [PMID:27025496] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Han Z,Zhang B,Zhao H,Ayaad M,Xing Y Genome-Wide Association Studies Reveal that Diverse Heading Date Genes Respond to Short and Long Day Lengths between Indica and Japonica Rice. Front Plant Sci, 2016. 7: p. 1270 [PMID:27621738]