![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00024372-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | CAMTA | ||||||||
| Protein Properties | Length: 79aa MW: 9522.82 Da PI: 9.8085 | ||||||||
| Description | CAMTA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CG-1 | 128.7 | 2.3e-40 | 11 | 79 | 36 | 104 |
CG-1 36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLee 104
gsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+een++fqrr+yw+Lee
WALNUT_00024372-RA 11 GGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEE 79
69*****************************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51437 | 53.329 | 1 | 79 | IPR005559 | CG-1 DNA-binding domain |
| SMART | SM01076 | 9.0E-28 | 1 | 79 | IPR005559 | CG-1 DNA-binding domain |
| Pfam | PF03859 | 6.8E-33 | 8 | 78 | IPR005559 | CG-1 DNA-binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MFTSHVFPIS GGSLFLFDRK VLRYFRKDGH NWRKKKDGKT VKEAHERLKA GSIDVLHCYY 60 AHGEENENFQ RRSYWMLEE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM434540 | 2e-47 | AM434540.2 Vitis vinifera contig VV78X210461.8, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008338581.2 | 6e-43 | calmodulin-binding transcription activator 3 isoform X1 | ||||
| Refseq | XP_009393546.1 | 6e-43 | PREDICTED: calmodulin-binding transcription activator 2 | ||||
| Refseq | XP_020421611.1 | 8e-43 | calmodulin-binding transcription activator 3 | ||||
| Swissprot | Q6NPP4 | 1e-40 | CMTA2_ARATH; Calmodulin-binding transcription activator 2 | ||||
| TrEMBL | B9SZ48 | 8e-43 | B9SZ48_RICCO; Calmodulin-binding transcription activator (Camta), plants, putative | ||||
| STRING | XP_009338097.1 | 3e-42 | (Pyrus x bretschneideri) | ||||
| STRING | XP_008338581.1 | 3e-42 | (Malus domestica) | ||||
| STRING | EMJ09374 | 3e-42 | (Prunus persica) | ||||
| STRING | Pavir.J38535.1.p | 5e-43 | (Panicum virgatum) | ||||
| STRING | XP_002531267.1 | 1e-43 | (Ricinus communis) | ||||
| STRING | Migut.L00133.1.p | 1e-43 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF14241 | 18 | 19 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64220.2 | 4e-43 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




